PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.DI7AJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 142aa    MW: 16007.2 Da    PI: 11.2066
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.DI7AJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-323689255
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 pr++Wtp+LH++F++a+++LGG ++AtPk +++lm+vkg+t++hvkSHLQ+YR+
  Araip.DI7AJ 36 PRICWTPDLHRCFLHAIQRLGGVDRATPKMVMQLMNVKGVTISHVKSHLQMYRS 89
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.393292IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-313290IPR009057Homeodomain-like
SuperFamilySSF466892.51E-163492IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-243689IPR006447Myb domain, plants
PfamPF002491.3E-53988IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MKSEDERVLI IVKASPTTTL SLKAPMVRPY VRSRMPRICW TPDLHRCFLH AIQRLGGVDR  60
ATPKMVMQLM NVKGVTISHV KSHLQMYRSV KQEEMKQGGT VNRVFCKGAV VELVIIPKNL  120
LAPNSKIFGM SSSSKSLRIM QS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016196431.12e-59PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLV7BP266e-44V7BP26_PHAVU; Uncharacterized protein
STRINGGLYMA09G00685.12e-42(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.16e-33G2-like family protein